Structure of PDB 5v1a Chain A Binding Site BS01

Receptor Information
>5v1a Chain A (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTYSIMDYKLGFVKTEV
IYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
Ligand information
>5v1a Chain B (length=26) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AEFTSPYFGRPSLKTRAKQFEGVSSP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v1a Recruitment of a SUMO isopeptidase to rDNA stabilizes silencing complexes by opposing SUMO targeted ubiquitin ligase activity.
Resolution2.14 Å
Binding residue
(original residue number in PDB)		E72 E79 Y80 R85 H87 W97 D99 I100 I115 D117 Y118 V137 R141
Binding residue
(residue number reindexed from 1)		E3 E10 Y11 R16 H18 W28 D30 I31 I38 D40 Y41 V55 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0033551 monopolin complex

View graph for
Cellular Component
External links
PDB RCSB:5v1a, PDBe:5v1a, PDBj:5v1a
PDBsum5v1a
PubMed28487408
UniProtP25651|CSM1_YEAST Monopolin complex subunit CSM1 (Gene Name=CSM1)

[Back to BioLiP]