Structure of PDB 5v0l Chain A Binding Site BS01

Receptor Information

>5v0l Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLT
ILRMAVSHMKSLKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDS
VTPQPQSEWFGSTLYDQVHPDDVDKLREQLSGSRRSFICRMRCEPHFVVV
HCTGYDDDPEAGQGSKFCLVAIGRLQ

Ligand information

>5v0l Chain C (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggattgcgtgagaactg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5v0l Structural hierarchy controlling dimerization and target DNA recognition in the AHR transcriptional complex.
Resolution	4.0 Å
Binding residue (original residue number in PDB)	R91 H94 R102 K128
Binding residue (residue number reindexed from 1)	R11 H14 R22 K48
Binding affinity	PDBbind-CN: Kd=4.86nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus
GO:0005667	transcription regulator complex
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v0l, PDBe:5v0l, PDBj:5v0l
PDBsum	5v0l
PubMed	28396409
UniProt	P27540\|ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator (Gene Name=ARNT)

[Back to BioLiP]