Structure of PDB 5uum Chain A Binding Site BS01

Receptor Information
>5uum Chain A (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
VQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLIS
FGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVEDLE
Ligand information
>5uum Chain C (length=23) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QWVREIAAGLRRAADDVNAQVER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uum Epistatic mutations in PUMA BH3 drive an alternate binding mode to potently and selectively inhibit anti-apoptotic Bfl-1.
Resolution2.346 Å
Binding residue
(original residue number in PDB)		H224 M231 K234 K238 N239 R248 V249 H252 V253 D256 N260 G262 R263 T266 F318 F319
Binding residue
(residue number reindexed from 1)		H55 M62 K65 K69 N70 R79 V80 H83 V84 D87 N91 G93 R94 T97 F149 F150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5uum, PDBe:5uum, PDBj:5uum
PDBsum5uum
PubMed28594323
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]