Structure of PDB 5uuk Chain A Binding Site BS01

Receptor Information
>5uuk Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVE
KNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGIL
IKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
PK
Ligand information
>5uuk Chain B (length=22) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QWVREIAAGLRRAADDVNAQVE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uuk Epistatic mutations in PUMA BH3 drive an alternate binding mode to potently and selectively inhibit anti-apoptotic Bfl-1.
Resolution1.199 Å
Binding residue
(original residue number in PDB)		N51 C55 N58 V59 Q73 V74 K77 E78 N85 G87 R88 T91 K147 F148
Binding residue
(residue number reindexed from 1)		N52 C56 N59 V60 Q74 V75 K78 E79 N86 G88 R89 T92 K148 F149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5uuk, PDBe:5uuk, PDBj:5uuk
PDBsum5uuk
PubMed28594323
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]