Structure of PDB 5uso Chain A Binding Site BS01

Receptor Information
>5uso Chain A (length=139) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPY
TSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLG
YLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uso Discrimination against RNA Backbones by a ssDNA Binding Protein.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K25 T26 W27 Y28 F47 M49 S54 S55 R57 R68 W72 D73 E85 K97 D99 H100 Y103 E105 H109
Binding residue
(residue number reindexed from 1)		K23 T24 W25 Y26 F45 M47 S52 S53 R55 R66 W70 D71 E83 K95 D97 H98 Y101 E103 H107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5uso, PDBe:5uso, PDBj:5uso
PDBsum5uso
PubMed29681468
UniProtO13988|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]