Structure of PDB 5usb Chain A Binding Site BS01

Receptor Information
>5usb Chain A (length=139) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPY
TSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLG
YLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5usb Discrimination against RNA Backbones by a ssDNA Binding Protein.
Resolution1.615 Å
Binding residue
(original residue number in PDB)		K25 W27 Y28 Y36 F47 M49 T53 S55 S56 R57 R68 W72 D73 K97 D99 H100 L101 E105 H109
Binding residue
(residue number reindexed from 1)		K23 W25 Y26 Y34 F45 M47 T51 S53 S54 R55 R66 W70 D71 K95 D97 H98 L99 E103 H107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5usb, PDBe:5usb, PDBj:5usb
PDBsum5usb
PubMed29681468
UniProtO13988|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]