Structure of PDB 5us2 Chain A Binding Site BS01

Receptor Information
>5us2 Chain A (length=132) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFL
AIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKL
VDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5us2 2-Se-T-modified-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D71 V72 S74 N105 E109 N132 Q134 K180 T183
Binding residue
(residue number reindexed from 1)		D10 V11 S13 N44 E48 N71 Q73 K119 T122
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:5us2, PDBe:5us2, PDBj:5us2
PDBsum5us2
PubMed
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]