Structure of PDB 5uml Chain A Binding Site BS01

Receptor Information
>5uml Chain A (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDAAAQHMV
YCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uml Design of ultrahigh-affinity and dual-specificity peptide antagonists of MDM2 and MDMX for p53 activation
Resolution3.0 Å
Binding residue
(original residue number in PDB)		M53 G57 I60 M61 Q71 H72 V92 K93
Binding residue
(residue number reindexed from 1)		M29 G33 I36 M37 Q47 H48 V68 K69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uml, PDBe:5uml, PDBj:5uml
PDBsum5uml
PubMed
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]