Structure of PDB 5ul6 Chain A Binding Site BS01

Receptor Information
>5ul6 Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIP
VPYVEKYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ul6 The Molecular Mechanisms Underlying the Hijack of Host Proteins by the 1918 Spanish Influenza Virus.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		F141 D142 D147 E149 D150 E166 Q168 W169 P183 Y186
Binding residue
(residue number reindexed from 1)		F8 D9 D14 E16 D17 E33 Q35 W36 P50 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ul6, PDBe:5ul6, PDBj:5ul6
PDBsum5ul6
PubMed28368102
UniProtP46108|CRK_HUMAN Adapter molecule crk (Gene Name=CRK)

[Back to BioLiP]