Structure of PDB 5udz Chain A Binding Site BS01

Receptor Information
>5udz Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHME
GFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYN
CGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
Ligand information
>5udz Chain V (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggguagugauuuuacccuggaga
<<<<<<.......>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5udz LIN28 Zinc Knuckle Domain Is Required and Sufficient to Induce let-7 Oligouridylation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		W46 F47 N48 V49 R50 M51 F53 F55 F73 H75 Q76 F84 R85 K102 G103 E105 K125
Binding residue
(residue number reindexed from 1)		W14 F15 N16 V17 R18 M19 F21 F23 F41 H43 Q44 F52 R53 K70 G71 E73 K93
Binding affinityPDBbind-CN: Kd=92nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5udz, PDBe:5udz, PDBj:5udz
PDBsum5udz
PubMed28297670
UniProtQ9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)

[Back to BioLiP]