Structure of PDB 5udl Chain A Binding Site BS01

Receptor Information
>5udl Chain A (length=460) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNL
LAYVKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYH
MGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNY
ERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLR
QAVRLNPDAGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYA
AKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMIQIKEATK
GQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR
KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIK
IEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEAE
EYYERAERLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5udl Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R38 Q42 L46 T48 W147 L150 K151 Y157 I183 R187 G190 F191 A194 Y218 Y252 Y256 K259 L286 H289 Q290 L293 K336 F339 V341 D345 D379
Binding residue
(residue number reindexed from 1)		R31 Q35 L39 T41 W140 L143 K144 Y150 I176 R180 G183 F184 A187 Y211 Y245 Y249 K252 L279 H282 Q283 L286 K329 F332 V334 D338 D372
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0009615 response to virus
GO:0019060 intracellular transport of viral protein in host cell
GO:0032091 negative regulation of protein binding
GO:0045070 positive regulation of viral genome replication
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0051097 negative regulation of helicase activity
GO:0051607 defense response to virus
GO:0051707 response to other organism
GO:0071357 cellular response to type I interferon
GO:0071360 cellular response to exogenous dsRNA
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5udl, PDBe:5udl, PDBj:5udl
PDBsum5udl
PubMed28251928
UniProtP09914|IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 (Gene Name=IFIT1)

[Back to BioLiP]