Structure of PDB 5ud5 Chain A Binding Site BS01

Receptor Information
>5ud5 Chain A (length=86) Species: 192952 (Methanosarcina mazei Go1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNN
SRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKA
Ligand information
>5ud5 Chain C (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaaccugaucauguagaucgaauggacucuaaauccguucagccgggu
uagauucccgggguuuccgc
<<<<<<<.<<<<.....>>>><<<<<<<.......>>>>>>>..<<<<<.
......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ud5 Crystal structures reveal an elusive functional domain of pyrrolysyl-tRNA synthetase.
Resolution2.347 Å
Binding residue
(original residue number in PDB)		K3 W16 S18 R19 T20 H24 L46 V48 N49 S51 R52 S53 S54 R55 R58 R61 H62 K64 Y65 R66
Binding residue
(residue number reindexed from 1)		K3 W16 S18 R19 T20 H24 L46 V48 N49 S51 R52 S53 S54 R55 R58 R61 H62 K64 Y65 R66
Enzymatic activity
Enzyme Commision number 6.1.1.26: pyrrolysine--tRNA(Pyl) ligase.
Gene Ontology
Molecular Function
GO:0004812 aminoacyl-tRNA ligase activity

View graph for
Molecular Function
External links
PDB RCSB:5ud5, PDBe:5ud5, PDBj:5ud5
PDBsum5ud5
PubMed29035363
UniProtQ8PWY1|PYLS_METMA Pyrrolysine--tRNA ligase (Gene Name=pylS)

[Back to BioLiP]