Structure of PDB 5uc6 Chain A Binding Site BS01

Receptor Information

>5uc6 Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGA
YKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETN
LLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQ
A

Ligand information

>5uc6 Chain B (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgugaguuauggguuagagucg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5uc6 Structural basis for IL-1 alpha recognition by a modified DNA aptamer that specifically inhibits IL-1 alpha signaling.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	M15 R16 K60 S61 K63 D64 D65 K67 I68 W113
Binding residue (residue number reindexed from 1)	M7 R8 K52 S53 K55 D56 D57 K59 I60 W105
Binding affinity	PDBbind-CN: Kd=7.3nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005125	cytokine activity
GO:0005149	interleukin-1 receptor binding

	Biological Process
GO:0006954	inflammatory response
GO:0006955	immune response

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5uc6, PDBe:5uc6, PDBj:5uc6
PDBsum	5uc6
PubMed	28993621
UniProt	P01583\|IL1A_HUMAN Interleukin-1 alpha (Gene Name=IL1A)

[Back to BioLiP]