Structure of PDB 5ua1 Chain A Binding Site BS01

Receptor Information

>5ua1 Chain A (length=177) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFP
SKVHLLVSALGREFSRIDAKATPFQRLNFMVGKLNRAMQRNPLLTEAMTR
AYVFADASAASEVDQVEKLIDSMFARAMANEPTEDQYHIARVISDVWLSN
LLAWLTRRASATDVSKRLDLAVRLLIG

Ligand information

>5ua1 Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actagaacgtgttctaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ua1 Crystal structure of KstR in complex with cognate DNA operator
Resolution	2.9 Å
Binding residue (original residue number in PDB)	R17 V48 A49 T52
Binding residue (residue number reindexed from 1)	R9 V40 A41 T44

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0042803	protein homodimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5ua1, PDBe:5ua1, PDBj:5ua1
PDBsum	5ua1
PubMed
UniProt	P96856\|KSTR_MYCTU HTH-type transcriptional repressor KstR (Gene Name=kstR)

[Back to BioLiP]