Structure of PDB 5u9b Chain A Binding Site BS01

Receptor Information

>5u9b Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRV
IACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKN

Ligand information

>5u9b Chain B (length=15) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gucucgcuuuucccc

...............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5u9b Structural Basis for Interaction of the Tandem Zinc Finger Domains of Human Muscleblind with Cognate RNA from Human Cardiac Troponin T.
Resolution	N/A
Binding residue (original residue number in PDB)	V3 S4 V5 I8 R9 D10 W13 L14 Q44 I51 A52 F54 R63 K67 Y68 E80 G83 R84 N86 L87 Q89
Binding residue (residue number reindexed from 1)	V3 S4 V5 I8 R9 D10 W13 L14 Q44 I51 A52 F54 R63 K67 Y68 E80 G83 R84 N86 L87 Q89
Binding affinity	PDBbind-CN: Kd=130nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:5u9b, PDBe:5u9b, PDBj:5u9b
PDBsum	5u9b
PubMed	28718627
UniProt	Q9NR56\|MBNL1_HUMAN Muscleblind-like protein 1 (Gene Name=MBNL1)

[Back to BioLiP]