Structure of PDB 5u6a Chain A Binding Site BS01

Receptor Information
>5u6a Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPILLSASVGDRVTITCRASQDVNTAVAWYQQRTNGSPRLLIYS
ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDEADYYCQQHYTTPPTFGA
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u6a Crystal Structure Of I83E Meditope-Enabled Trastuzumab With Azido-PEG3-Meditope
Resolution1.736 Å
Binding residue
(original residue number in PDB)		I9 Q38 T40 N41 G42 E83 A84 D85 Y87 K103 E165
Binding residue
(residue number reindexed from 1)		I9 Q38 T40 N41 G42 E83 A84 D85 Y87 K103 E165
External links