Structure of PDB 5u5s Chain A Binding Site BS01

Receptor Information
>5u5s Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHP
MDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQ
DVFEFRYAKMPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u5s Distinct Roles of Brd2 and Brd4 in Potentiating the Transcriptional Program for Th17 Cell Differentiation.
ResolutionN/A
Binding residue
(original residue number in PDB)
W27 V33 L38 G39 L40 H41 I46 K84 Y85 N86 H90 V92
Binding residue
(residue number reindexed from 1)
W27 V33 L38 G39 L40 H41 I46 K84 Y85 N86 H90 V92
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5u5s, PDBe:5u5s, PDBj:5u5s
PDBsum5u5s
PubMed28262505
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]