Structure of PDB 5u3l Chain A Binding Site BS01

Receptor Information
>5u3l Chain A (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGLVKPGGSLTLSCSASGFFFDNSWMGWVRQAPGKGLEWVGR
IRRLKDGATGEYGAAVKDRFTISRDDSRNMLYLHMRTLKTEDSGTYYCTM
DEGTPVTRFLEWGYFYYYMAVWGRGTTVIVSSASTKGPSVFPLAGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTTYICNVNHKPSNTKVDKRVEP
Ligand information
>5u3l Chain C (length=19) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKKWNWFDITNWLWYIRKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u3l Potent and broad HIV-neutralizing antibodies in memory B cells and plasma.
Resolution2.165 Å
Binding residue
(original residue number in PDB)		N31 W33 R52A K52C D53 G97 P99 L100D W100F G100G F100I
Binding residue
(residue number reindexed from 1)		N31 W33 R53 K55 D56 G103 P105 L110 W112 G113 F115
External links