Structure of PDB 5u2j Chain A Binding Site BS01

Receptor Information
>5u2j Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDPIPICSFCLGTKESNREKKPEELLSCADCGSSGHPSCLKFCPELTTNV
KALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPK
GMWICQVCRPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u2j Recognition of Histone H3K14 Acylation by MORF.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
S210 F211 L213 S235 S236 C241 L242 K243 I260 E261 A275 D276 M278 L279 F280 D282 D285 M300 P301 G303
Binding residue
(residue number reindexed from 1)
S8 F9 L11 S33 S34 C39 L40 K41 I58 E59 A73 D74 M76 L77 F78 D80 D83 M98 P99 G101
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:5u2j, PDBe:5u2j, PDBj:5u2j
PDBsum5u2j
PubMed28286003
UniProtQ8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B (Gene Name=KAT6B)

[Back to BioLiP]