Structure of PDB 5tzp Chain A Binding Site BS01

Receptor Information
>5tzp Chain A (length=138) Species: 928301 (Fowlpox virus strain NVSL) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTN
YNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKVKQDTS
PQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKN
Ligand information
>5tzp Chain B (length=22) Species: 9031 (Gallus gallus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ISSAIQVGHQLALIGDEFNRAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tzp Structural basis of apoptosis inhibition by the fowlpox virus protein FPV039.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		V51 I72 Q75 V76 N82 G84 R85 T88 Y141
Binding residue
(residue number reindexed from 1)		V46 I67 Q70 V71 N77 G79 R80 T83 Y136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5tzp, PDBe:5tzp, PDBj:5tzp
PDBsum5tzp
PubMed28411240
UniProtQ9J5G4|ARBH_FOWPN Apoptosis regulator Bcl-2 homolog (Gene Name=FPV039)

[Back to BioLiP]