Structure of PDB 5twg Chain A Binding Site BS01

Receptor Information
>5twg Chain A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKKNSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQI
NMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYL
MTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFD
SVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5twg MOB1 Mediated Phospho-recognition in the Core Mammalian Hippo Pathway.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R92 Y93 E94 Y95 H96 P106 R157
Binding residue
(residue number reindexed from 1)		R74 Y75 E76 Y77 H78 P88 R139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030295 protein kinase activator activity
GO:0043539 protein serine/threonine kinase activator activity
GO:0046872 metal ion binding
Biological Process
GO:0035329 hippo signaling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5twg, PDBe:5twg, PDBj:5twg
PDBsum5twg
PubMed28373298
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]