Structure of PDB 5twa Chain A Binding Site BS01

Receptor Information
>5twa Chain A (length=161) Species: 6047 (Geodia cydonium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSSRLYLQNTAVMEELYRRNLEYWREDGLSEEERRTAADAAERMTAV
IAGTPGIAVERNVRDFRRGGWDVTPDNVESEFREVERRTFSDGVHWGRVI
AFLAFSMSFAAYVNSRGIDGGAYSVFNWTLRVLNDSLADFIQRENGWRGF
IVYADTLLRAQ
Ligand information
>5twa Chain D (length=25) Species: 289074 (Lubomirskia baikalensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASSMASEVGRRLAEFGDQVDGQFYQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5twa Structural insight into an evolutionarily ancient programmed cell death regulator - the crystal structure of marine sponge BHP2 bound to LB-Bak-2.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		G93 G106 W108 E118 E121 V122 R125 T126 H132 G134 R135 A138 F142 Y190 T193 L194
Binding residue
(residue number reindexed from 1)		G56 G69 W71 E81 E84 V85 R88 T89 H95 G97 R98 A101 F105 Y153 T156 L157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5twa, PDBe:5twa, PDBj:5twa
PDBsum5twa
PubMed28079890
UniProtQ967D2

[Back to BioLiP]