Structure of PDB 5tuv Chain A Binding Site BS01

Receptor Information
>5tuv Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQA
RPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIE
VLKRMGM
Ligand information
>5tuv Chain C (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SALLYKFNGSPSKSLKDINNMIRQGEQRT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tuv Conservation and divergence of C-terminal domain structure in the retinoblastoma protein family.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		P260 I262 E292 I293 D295
Binding residue
(residue number reindexed from 1)		P62 I64 E94 I95 D97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tuv, PDBe:5tuv, PDBj:5tuv
PDBsum5tuv
PubMed28439018
UniProtQ14186|TFDP1_HUMAN Transcription factor Dp-1 (Gene Name=TFDP1)

[Back to BioLiP]