Structure of PDB 5tp1 Chain A Binding Site BS01

Receptor Information
>5tp1 Chain A (length=150) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDT
LTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQEL
EAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKN
Ligand information
>5tp1 Chain P (length=21) Species: 272561 (Chlamydia trachomatis D/UW-3/CX) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPTVQFFKGKNGSADKVILVT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tp1 Chlamydia interfere with an interaction between the mannose-6-phosphate receptor and sorting nexins to counteract host restriction.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		P36 D37 A38 L39 S40 E41 M106 Q107 E129 Y132 L133 F136 K137
Binding residue
(residue number reindexed from 1)		P8 D9 A10 L11 S12 E13 M78 Q79 E101 Y104 L105 F108 K109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5tp1, PDBe:5tp1, PDBj:5tp1
PDBsum5tp1
PubMed28252385
UniProtQ9D8U8|SNX5_MOUSE Sorting nexin-5 (Gene Name=Snx5)

[Back to BioLiP]