Structure of PDB 5tkz Chain A Binding Site BS01

Receptor Information
>5tkz Chain A (length=89) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVRTLFVSGLPMDAKPRELYLLFRGARGYEGALLKMTSKNGKPTSPVGFV
TFLSQQDAQDARKMLQGVRFDPEAAQVLRLELAKSNTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tkz Conserved binding of GCAC motifs by MEC-8, couch potato, and the RBPMS protein family.
Resolution1.529 Å
Binding residue
(original residue number in PDB)		F34 K63 T65 S73 V75 F77 R107 E109 A111 K112 S113 N114 T115 K116 V117
Binding residue
(residue number reindexed from 1)		F6 K35 T37 S45 V47 F49 R79 E81 A83 K84 S85 N86 T87 K88 V89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5tkz, PDBe:5tkz, PDBj:5tkz
PDBsum5tkz
PubMed28003515
UniProtG5ECJ4

[Back to BioLiP]