Structure of PDB 5tkj Chain A Binding Site BS01

Receptor Information
>5tkj Chain A (length=211) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGTELVWPGTSVTLSCKASGYTFTDYEIHWVKQTPVHGLEWIGA
IVPKTGYTAYNQKFRGKAILTADKSSSTAYMDLRRLTSEDSAVYYCTRLR
NYWYFDVWGTGTTVTVSPASTKGPSVFPLAPGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEP
Ligand information
>5tkj Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tkj Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1.
Resolution2.118 Å
Binding residue
(original residue number in PDB)
E33 A50 Y56 A58 L95 N97 Y98 W99
Binding residue
(residue number reindexed from 1)
E33 A50 Y57 A59 L99 N101 Y102 W103
External links