Structure of PDB 5tgj Chain A Binding Site BS01

Receptor Information
>5tgj Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTL
IETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELE
AEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQP
Ligand information
>5tgj Chain B (length=22) Species: 813 (Chlamydia trachomatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPAVQFFKGKNGSADQVILVTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tgj Structure of the SNX5 PX domain in complex with chlamydial protein IncE
Resolution2.6 Å
Binding residue
(original residue number in PDB)		I35 P36 D37 A38 L39 S40 E41 R42 Y132 F136 E144
Binding residue
(residue number reindexed from 1)		I6 P7 D8 A9 L10 S11 E12 R13 Y103 F107 E115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5tgj, PDBe:5tgj, PDBj:5tgj
PDBsum5tgj
PubMed
UniProtQ9Y5X3|SNX5_HUMAN Sorting nexin-5 (Gene Name=SNX5)

[Back to BioLiP]