Structure of PDB 5tgi Chain A Binding Site BS01

Receptor Information
>5tgi Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTL
IETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELE
AEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYD
Ligand information
>5tgi Chain C (length=20) Species: 813 (Chlamydia trachomatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVQFFKGKNGSADQVILVTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tgi Structure of the SNX5 PX domain in complex with chlamydial protein IncE
Resolution1.98 Å
Binding residue
(original residue number in PDB)		I35 P36 D37 A38 L39 S40 M106 E129 Y132 L133 F136 K137 E144
Binding residue
(residue number reindexed from 1)		I6 P7 D8 A9 L10 S11 M77 E100 Y103 L104 F107 K108 E115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5tgi, PDBe:5tgi, PDBj:5tgi
PDBsum5tgi
PubMed
UniProtQ9Y5X3|SNX5_HUMAN Sorting nexin-5 (Gene Name=SNX5)

[Back to BioLiP]