Structure of PDB 5tdw Chain A Binding Site BS01

Receptor Information
>5tdw Chain A (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDP
REVDINLARKIQQERINVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tdw Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
G14 F15 T16 I17 Q18 C19 N23 I36 P40 D41
Binding residue
(residue number reindexed from 1)
G14 F15 T16 I17 Q18 C19 N23 I36 P40 D41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5tdw, PDBe:5tdw, PDBj:5tdw
PDBsum5tdw
PubMed27697561
UniProtP36124|SET3_YEAST SET domain-containing protein 3 (Gene Name=SET3)

[Back to BioLiP]