Structure of PDB 5tdd Chain A Binding Site BS01

Receptor Information
>5tdd Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGG
GGFCDCGDTEAWKEGPYCQKHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tdd Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		T120 S143 G147 F148 D150
Binding residue
(residue number reindexed from 1)		T25 S48 G52 F53 D55
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5tdd, PDBe:5tdd, PDBj:5tdd
PDBsum5tdd
PubMed28392261
UniProtQ8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 (Gene Name=UBR2)

[Back to BioLiP]