Structure of PDB 5tdc Chain A Binding Site BS01

Receptor Information
>5tdc Chain A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LCGRVFKSGETTYSCRDCAIDPTCVLCMDCFQDSVHKNHRYKMHTSTGGG
FCDCGDTEAWKTGPFCVNHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tdc Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.
Resolution1.607 Å
Binding residue
(original residue number in PDB)		T120 V122 H141 G147 F148 D150 D153 E155
Binding residue
(residue number reindexed from 1)		T23 V25 H44 G50 F51 D53 D56 E58
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5tdc, PDBe:5tdc, PDBj:5tdc
PDBsum5tdc
PubMed28392261
UniProtQ8IWV7|UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)

[Back to BioLiP]