Structure of PDB 5tdb Chain A Binding Site BS01

Receptor Information
>5tdb Chain A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGG
FCDCGDTEAWKEGPYCQKHE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tdb Bound Waters Mediate Binding of Diverse Substrates to a Ubiquitin Ligase.
Resolution1.101 Å
Binding residue
(original residue number in PDB)		D118 T120 C121 V122 G147 F148 D150 E155 A156
Binding residue
(residue number reindexed from 1)		D21 T23 C24 V25 G50 F51 D53 E58 A59
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5tdb, PDBe:5tdb, PDBj:5tdb
PDBsum5tdb
PubMed28392261
UniProtQ8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 (Gene Name=UBR2)

[Back to BioLiP]