Structure of PDB 5td5 Chain A Binding Site BS01

Receptor Information
>5td5 Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYLMDPDTFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHMGFLCNES
GRHAALRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQEN
THVRLRIKAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVY
RQGCPFQPWDGLEEHSQALSGRLRAILQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5td5 Structural basis for targeted DNA cytosine deamination and mutagenesis by APOBEC3A and APOBEC3B.
Resolution1.718 Å
Binding residue
(original residue number in PDB)		I209 R211 H212 K213 T214 N240 H253 W281 S282 Y313 D314 Y315
Binding residue
(residue number reindexed from 1)		I17 R19 H20 K21 T22 N48 H53 W81 S82 Y113 D114 Y115
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity

View graph for
Molecular Function
External links
PDB RCSB:5td5, PDBe:5td5, PDBj:5td5
PDBsum5td5
PubMed27991903
UniProtQ9UH17|ABC3B_HUMAN DNA dC->dU-editing enzyme APOBEC-3B (Gene Name=APOBEC3B)

[Back to BioLiP]