Structure of PDB 5tbd Chain A Binding Site BS01

Receptor Information
>5tbd Chain A (length=114) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVRLQQSGAELVKPGASVKLSCTASGFNIKDDYMHWVKQRPEQGLEWIGR
IDPANGNTQYAPKFQDKATITADTSSNTAYLQLTSLTSEDTAVYYCARGG
LLRWGQGTSVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tbd Structure and Characterisation of a Key Epitope in the Conserved C-Terminal Domain of the Malaria Vaccine Candidate MSP2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
K30 D31 D32 Y33 H35 R50 D52 G99 G100
Binding residue
(residue number reindexed from 1)
K30 D31 D32 Y33 H35 R50 D52 G99 G100
External links