Structure of PDB 5t90 Chain A Binding Site BS01

Receptor Information

>5t90 Chain A (length=205) Species: 6523 (Lymnaea stagnalis)

LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDV
VFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTP
QLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREI
SVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLN
FRKKG

Ligand information

>5t90 Chain F (length=17) Species: 6490 (Conus)

SGCCSNPACRVNNPNIC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5t90 Structural mechanisms for alpha-conotoxin activity at the human alpha 3 beta 4 nicotinic acetylcholine receptor.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): W53 Q73 R104 M114 Y164
• Binding residue (residue number reindexed from 1): W53 Q73 R104 M114 Y164

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0043083 synaptic cleft
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:5t90, PDBe:5t90, PDBj:5t90
• PDBsum: 5t90
• PubMed: 28361878
• UniProt: P58154|ACHP_LYMST Acetylcholine-binding protein