Structure of PDB 5t6j Chain A Binding Site BS01

Receptor Information
>5t6j Chain A (length=59) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKT
KYIWERLGK
Ligand information
>5t6j Chain C (length=12) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QQLLKGLSLSFS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t6j Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly.
Resolution1.752 Å
Binding residue
(original residue number in PDB)		E157 L160 L164 S167
Binding residue
(residue number reindexed from 1)		E3 L6 L10 S13
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5t6j, PDBe:5t6j, PDBj:5t6j
PDBsum5t6j
PubMed27881300
UniProtQ04477|SPC24_YEAST Kinetochore protein SPC24 (Gene Name=SPC24)

[Back to BioLiP]