Structure of PDB 5t63 Chain A Binding Site BS01

Receptor Information

>5t63 Chain A (length=283) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SESFVAAAVSRSGPAVVRIDTEQGSGFIIDNSGIILTNAHVVDGASKVVV
TLRDGRTFDGQVRGTDEVTDLAVVKIEPQGSALPVAPLGTSSNLQVGDWA
IAVGNPVGLDNTVTLGIISTLGEFIQTDAAINPGNSGGPLLNARGEVIGI
NTAITGIGFAIPIDQAKAIQNTLAAGGTVPHPYIGVQMMNITVDQAQQNN
RNPNSPFIIPEVDGILVMRVLPGTPAERAGIRRGDVIVAVDGTPISDGAR
LQRIVEQAGLNKALKLDLLRRRLSLTVQTAQLR

Ligand information

>5t63 Chain C (length=4) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t63 The HhoA protease from Synechocystis sp. PCC 6803 - Novel insights into structure and activity regulation.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	Y288 I289 G290 V291 Q292 M293 Q357
Binding residue (residue number reindexed from 1)	Y183 I184 G185 V186 Q187 M188 Q252

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0008233	peptidase activity
GO:0042802	identical protein binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0030288	outer membrane-bounded periplasmic space
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t63, PDBe:5t63, PDBj:5t63
PDBsum	5t63
PubMed	27956128
UniProt	P72780\|HHOA_SYNY3 Putative serine protease HhoA (Gene Name=hhoA)

[Back to BioLiP]