Structure of PDB 5t4i Chain A Binding Site BS01

Receptor Information
>5t4i Chain A (length=297) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADR
KHCKFKPDPNIPPTFSAFNEDYVGSGWSRGAMAPAGNNKFSSKAMAETFY
LSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGK
KIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQ
PQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTL
YLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t4i A domain in human EXOG converts apoptotic endonuclease to DNA-repair exonuclease.
Resolution2.389 Å
Binding residue
(original residue number in PDB)		R109 S137 R138 G139 A140 A144 G145 K148 F168 N171 S172 N176 R314
Binding residue
(residue number reindexed from 1)		R50 S78 R79 G80 A81 A85 G86 K89 F109 N112 S113 N117 R255
Enzymatic activity
Catalytic site (original residue number in PDB) C112 A140 N162 N171 E179
Catalytic site (residue number reindexed from 1) C53 A81 N103 N112 E120
Enzyme Commision number 3.1.30.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5t4i, PDBe:5t4i, PDBj:5t4i
PDBsum5t4i
PubMed28466855
UniProtQ9Y2C4|EXOG_HUMAN Nuclease EXOG, mitochondrial (Gene Name=EXOG)

[Back to BioLiP]