Structure of PDB 5t1g Chain A Binding Site BS01

Receptor Information
>5t1g Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCP
QVVISFYEERL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t1g chromo shadow domain of CBX1 in complex with a histone peptide
Resolution1.9 Å
Binding residue
(original residue number in PDB)		I123 G124 A125 T126 F163 R167
Binding residue
(residue number reindexed from 1)		I16 G17 A18 T19 F56 R60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5t1g, PDBe:5t1g, PDBj:5t1g
PDBsum5t1g
PubMed
UniProtP83916|CBX1_HUMAN Chromobox protein homolog 1 (Gene Name=CBX1)

[Back to BioLiP]