Structure of PDB 5t0q Chain A Binding Site BS01

Receptor Information
>5t0q Chain A (length=171) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQFNEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGD
GYYKGENTAEQEHRKRVIRELNSLEEVTDTEWFFLVSMTQSFVNGVGLPG
ESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGS
SEVISQSSDLMHKVNNLFNFN
Ligand information
>5t0q Chain B (length=17) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PIARRKSLQRFLEKRKE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t0q Structural insights into alternative splicing-mediated desensitization of jasmonate signaling.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		Q53 W92 D94 Y97 N126 E142 E148 F151 M155 T156
Binding residue
(residue number reindexed from 1)		Q9 W48 D50 Y53 N72 E75 E81 F84 M88 T89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5t0q, PDBe:5t0q, PDBj:5t0q
PDBsum5t0q
PubMed28137867
UniProtQ9FIP9|MYC3_ARATH Transcription factor MYC3 (Gene Name=MYC3)

[Back to BioLiP]