Structure of PDB 5t0k Chain A Binding Site BS01

Receptor Information
>5t0k Chain A (length=264) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNIT
HLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQ
ACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVG
ELISDAEADVREDDSYLFDLDEVYCIDARYYGNISRFINHLCDPNIIPVR
VFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSE
KCKHSAEAIALEQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t0k A histone H3K9M mutation traps histone methyltransferase Clr4 to prevent heterochromatin spreading.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y1067 D1074 A1077 D1078 D1083 L1086 F1087 D1088 Y1154 R1157 F1158 I1161 K1162
Binding residue
(residue number reindexed from 1)		Y148 D155 A158 D159 D164 L167 F168 D169 Y231 R234 F235 I238 K239
Enzymatic activity
Catalytic site (original residue number in PDB) Y1067 Y1154
Catalytic site (residue number reindexed from 1) Y148 Y231
Enzyme Commision number 2.1.1.-
2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0008270 zinc ion binding
GO:0016279 protein-lysine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5t0k, PDBe:5t0k, PDBj:5t0k
PDBsum5t0k
PubMed27648579
UniProtQ96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)

[Back to BioLiP]