Structure of PDB 5szx Chain A Binding Site BS01

Receptor Information

>5szx Chain A (length=62) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPS
LDVDSIIPRTPD

Ligand information

>5szx Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcttcatcgctcagtgct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5szx Methyl-dependent and spatial-specific DNA recognition by the orthologous transcription factors human AP-1 and Epstein-Barr virus Zta.
Resolution	2.251 Å
Binding residue (original residue number in PDB)	R179 N182 R183 S186 R187 R190 K194
Binding residue (residue number reindexed from 1)	R5 N8 R9 S12 R13 R16 K20
Binding affinity	PDBbind-CN: Kd=0.017uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5szx, PDBe:5szx, PDBj:5szx
PDBsum	5szx
PubMed	28158710
UniProt	P03206\|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]