Structure of PDB 5sze Chain A Binding Site BS01

Receptor Information
>5sze Chain A (length=71) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMPYKLQESFLNTARKKRVKVSVYLVNGVRLQGRIRSFDLFTILLEDGKQ
QTLVYKHAITTIVPHERLEIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5sze Crystal structure and RNA-binding properties of an Hfq homolog from the deep-branching Aquificae: conservation of the lateral RNA-binding mode.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		N14 R17 S39 F40
Binding residue
(residue number reindexed from 1)		N12 R15 S37 F38
Binding affinityPDBbind-CN: Kd=21.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5sze, PDBe:5sze, PDBj:5sze
PDBsum5sze
PubMed28375142
UniProtO66512|HFQ_AQUAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]