Structure of PDB 5szc Chain A Binding Site BS01

Receptor Information
>5szc Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMT
EAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEP
PEGSWSCHLCWELLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5szc Identification of H3K4me1-associated proteins at mammalian enhancers.
Resolution1.193 Å
Binding residue
(original residue number in PDB)
D263 F264 R289 S290 I314 E315 K317 D328 D329 L331 L332 F333 C334 D335 D338 P354 G356
Binding residue
(residue number reindexed from 1)
D10 F11 R36 S37 I61 E62 K64 D75 D76 L78 L79 F80 C81 D82 D85 P101 G103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5szc, PDBe:5szc, PDBj:5szc
PDBsum5szc
PubMed29255264
UniProtQ92784|DPF3_HUMAN Zinc finger protein DPF3 (Gene Name=DPF3)

[Back to BioLiP]