Structure of PDB 5sxp Chain A Binding Site BS01

Receptor Information
>5sxp Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGW
FPSNYVREVKA
Ligand information
>5sxp Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKPSRPPRPSRPPPPTPRRPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5sxp Molecular basis of interactions between SH3 domain-containing proteins and the proline-rich region of the ubiquitin ligase Itch.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		F193 W221 W232 Y237
Binding residue
(residue number reindexed from 1)		F11 W39 W50 Y55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5sxp, PDBe:5sxp, PDBj:5sxp
PDBsum5sxp
PubMed28235806
UniProtQ14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 (Gene Name=ARHGEF7)

[Back to BioLiP]