Structure of PDB 5svi Chain A Binding Site BS01

Receptor Information

>5svi Chain A (length=46) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDQTWVQCDACLKWRKLPDGMLPEKWYCSNNPDPQFRNCEVPEEPE

Ligand information

>5svi Chain C (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ARTKQTAR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5svi Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
Resolution	1.613 Å
Binding residue (original residue number in PDB)	S0 D407 Q408 T409 W410 V411 Q412 W419 D424 P430 E431 E453
Binding residue (residue number reindexed from 1)	S1 D2 Q3 T4 W5 V6 Q7 W14 D19 P23 E24 E46

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:5svi, PDBe:5svi, PDBj:5svi
PDBsum	5svi
PubMed	27653685
UniProt	Q14149\|MORC3_HUMAN MORC family CW-type zinc finger protein 3 (Gene Name=MORC3)

[Back to BioLiP]