Structure of PDB 5qu2 Chain A Binding Site BS01

Receptor Information
>5qu2 Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPS
NYVERK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5qu2 Small molecule AX-024 reduces T cell proliferation independently of CD3ε/Nck1 interaction, which is governed by a domain swap in the Nck1-SH3.1 domain.
Resolution1.04 Å
Binding residue
(original residue number in PDB)		F9 Q15 E18 K34 S35 W36 F48 P50 N52 Y53
Binding residue
(residue number reindexed from 1)		F8 Q14 E17 K33 S34 W35 F47 P49 N51 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5qu2, PDBe:5qu2, PDBj:5qu2
PDBsum5qu2
PubMed32317279
UniProtP16333|NCK1_HUMAN SH2/SH3 adapter protein NCK1 (Gene Name=NCK1)

[Back to BioLiP]