Structure of PDB 5ow5 Chain A Binding Site BS01

Receptor Information

>5ow5 Chain A (length=170) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LVDEDAMSQIRKGHDTMFVVLTSRHKNLDTVRAVWTTGDIKTSVDSAVAI
NDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTS
LKLILQRFLPLITDILAAPPSDISREERLHKCRLCFKQLKSISGLVKSKS
GLSGRHGSAFRELHLLMASL

Ligand information

>5ow5 Chain E (length=10) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IEEALQIIHS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ow5 Structural Basis of Formation of the Microtubule Minus-End-Regulating CAMSAP-Katanin Complex.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	T500 K573 Y574
Binding residue (residue number reindexed from 1)	T16 K89 Y90

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008017	microtubule binding

View graph for
Molecular Function

External links

PDB	RCSB:5ow5, PDBe:5ow5, PDBj:5ow5
PDBsum	5ow5
PubMed	29395789
UniProt	Q8BG40\|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 (Gene Name=Katnb1)

[Back to BioLiP]