Structure of PDB 5ovv Chain A Binding Site BS01

Receptor Information
>5ovv Chain A (length=99) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YFQSVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVE
GVAWKAGLRTGDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ovv Structural basis for PDZ domain interactions in the post-synaptic density scaffolding protein Shank3.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		G590 F591 F593 V594 L595 R596 G597 A598 K599 H652 K653
Binding residue
(residue number reindexed from 1)		G15 F16 F18 V19 L20 R21 G22 A23 K24 H77 K78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ovv, PDBe:5ovv, PDBj:5ovv
PDBsum5ovv
PubMed29473168
UniProtQ9JLU4|SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 (Gene Name=Shank3)

[Back to BioLiP]