Structure of PDB 5ovc Chain A Binding Site BS01

Receptor Information
>5ovc Chain A (length=96) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVA
WKAGLRTGDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ovc Structural basis for PDZ domain interactions in the post-synaptic density scaffolding protein Shank3.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		G590 F591 G592 F593 V594 L595 R596 G597 K599 T602 Y618 E620 D623 H652
Binding residue
(residue number reindexed from 1)		G12 F13 G14 F15 V16 L17 R18 G19 K21 T24 Y40 E42 D45 H74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ovc, PDBe:5ovc, PDBj:5ovc
PDBsum5ovc
PubMed29473168
UniProtQ9JLU4|SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 (Gene Name=Shank3)

[Back to BioLiP]